CD8B1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-218	50 μL

Catalog No. 89-104-218 Supplier Abnova Corporation Supplier No. H00000926A01

Description

Mouse polyclonal antibody raised against a partial recombinant CD8B1.

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. [provided by RefSeq

Sequence: QQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQ

Specifications

• Antigen: CD8B1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CD8B1.
• Formulation: 50% glycerol
• Gene: CD8B
• Gene Accession No.: NM_004931
• Gene Alias: CD8B1/LYT3/Leu2/Ly3/MGC119115
• Gene Symbols: CD8B
• Host Species: Mouse
• Immunogen: CD8B1 (NP_004922, 23 a.a. to 131 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 926
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only