CDC6, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-245	50 μL

Catalog No. 89-104-245 Supplier Abnova Corporation Supplier No. H00000990A01

Description

Mouse polyclonal antibody raised against a partial recombinant CDC6.

The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc6, a protein essential for the initiation of DNA replication. This protein functions as a regulator at the early steps of DNA replication. It localizes in cell nucleus during cell cyle G1, but translocates to the cytoplasm at the start of S phase. The subcellular translocation of this protein during cell cyle is regulated through its phosphorylation by Cdks. Transcription of this protein was reported to be regulated in response to mitogenic signals through transcriptional control mechanism involving E2F proteins. [provided by RefSeq

Sequence: ISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVF

Specifications

• Antigen: CDC6
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CDC6.
• Formulation: 50% glycerol
• Gene: CDC6
• Gene Accession No.: NM_001254
• Gene Alias: CDC18L/HsCDC18/HsCDC6
• Gene Symbols: CDC6
• Host Species: Mouse
• Immunogen: CDC6 (NP_001245, 434 a.a. to 533 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 990
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only