CDK4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-258	50 μL

Catalog No. 89-104-258 Supplier Abnova Corporation Supplier No. H00001019A01

Description

Mouse polyclonal antibody raised against a full-length recombinant CDK4.

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq

Sequence: KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Specifications

• Antigen: CDK4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant CDK4.
• Formulation: 50% glycerol
• Gene: CDK4
• Gene Accession No.: BC003644
• Gene Alias: CMM3/MGC14458/PSK-J3
• Gene Symbols: CDK4
• Host Species: Mouse
• Immunogen: CDK4 (AAH03644, 211 a.a. to 303 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1019
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only