Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105943

CDKL1, Mouse, Clone: 8B2, Abnova™

Catalog No. 89105943 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-943 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-943 Supplier Abnova Corporation Supplier No. H00008814M02A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CDKL1.

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Alternative splice variants encoding different protein isoforms have been described, but their full-length nature has not been determined. [provided by RefSeq

Sequence: YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI

Specifications

Antigen CDKL1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 8B2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CDKL1.
Formulation ascites with no preservative
Gene CDKL1
Gene Accession No. NM_004196
Gene Alias KKIALRE/p42
Gene Symbols CDKL1
Host Species Mouse
Immunogen CDKL1 (NP_004187,259 a.a. ∽ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8814
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.