CDKN2B, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-265	50 μL

Catalog No. 89-104-265 Supplier Abnova Corporation Supplier No. H00001030A01

Description

Mouse polyclonal antibody raised against a full-length recombinant CDKN2B.

This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq

Sequence: MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

Specifications

• Antigen: CDKN2B
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant CDKN2B.
• Formulation: 50% glycerol
• Gene: CDKN2B
• Gene Accession No.: BC014469
• Gene Alias: CDK4I/INK4B/MTS2/P15/TP15/p15INK4b
• Gene Symbols: CDKN2B
• Host Species: Mouse
• Immunogen: CDKN2B (AAH14469, 1 a.a. to 138 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1030
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only