Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDX2, Mouse, Clone: 1C19, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CDX2.

Manufacturer:  Abnova Corporation H00001045M02

Catalog No. 89-104-270


Add to cart

Description

Description

The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al., 1994 [PubMed 7698771]).[supplied by OMIM

Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ
Specifications

Specifications

CDX2
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
BC014461
CDX-3/CDX3
Mouse
IgG3 Kappa
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1045
ELISA, Western Blot
1C19
Mouse monoclonal antibody raised against a full-length recombinant CDX2.
CDX2
Purified
CDX2
CDX2 (AAH14461.1,1 a.a. ∽ 313 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein A Purification
RUO
Antibody
Monoclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit