CDX2, Mouse, Clone: 1C19, Abnova™

Catalog No.	Quantity
89-104-270	100 μg

Catalog No. 89-104-270 Supplier Abnova Corporation Supplier No. H00001045M02

Description

Mouse monoclonal antibody raised against a full-length recombinant CDX2.

The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al., 1994 [PubMed 7698771]).[supplied by OMIM

Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ

Specifications

• Antigen: CDX2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1C19
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant CDX2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CDX2
• Gene Accession No.: BC014461
• Gene Alias: CDX-3/CDX3
• Gene Symbols: CDX2
• Host Species: Mouse
• Immunogen: CDX2 (AAH14461.1,1 a.a. ∽ 313 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Protein A Purification
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1045
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG3 κ