Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CFD, Mouse, Clone: 5F20, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CFD.

Manufacturer:  Abnova Corporation H00001675M02

Catalog No. 89-104-384


Add to cart

Description

Description

The protein encoded by this gene is a member of the trypsin family of peptidases. The encoded protein is a component of the alternative complement pathway best known for its role in humoral suppression of infectious agents. This protein is also a serine protease that is secreted by adipocytes into the bloodstream. Finally, the encoded protein has a high level of expression in fat, suggesting a role for adipose tissue in immune system biology. [provided by RefSeq

Sequence: GIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
Specifications

Specifications

CFD
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
NM_001928.2
ADIPSIN/ADN/DF/PFD
Mouse
IgG2a Kappa
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1675
ELISA, Western Blot
5F20
Mouse monoclonal antibody raised against a partial recombinant CFD.
CFD
Purified
CFD
CFD (NP_001919.2,154 a.a. ∽ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein A Purification
RUO
Antibody
Monoclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit