Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CFD, Mouse, Clone: 5F20, Abnova™

Catalog No. 89104384 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-384 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-384 Supplier Abnova Corporation Supplier No. H00001675M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CFD.

The protein encoded by this gene is a member of the trypsin family of peptidases. The encoded protein is a component of the alternative complement pathway best known for its role in humoral suppression of infectious agents. This protein is also a serine protease that is secreted by adipocytes into the bloodstream. Finally, the encoded protein has a high level of expression in fat, suggesting a role for adipose tissue in immune system biology. [provided by RefSeq

Sequence: GIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA

Specifications

Antigen CFD
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5F20
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CFD.
Formulation PBS with no preservative; pH 7.4
Gene CFD
Gene Accession No. NM_001928.2
Gene Alias ADIPSIN/ADN/DF/PFD
Gene Symbols CFD
Host Species Mouse
Immunogen CFD (NP_001919.2,154 a.a. ∽ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1675
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.