CFTR, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-275	50 μL

Catalog No. 89-104-275 Supplier Abnova Corporation Supplier No. H00001080A01

Description

Mouse polyclonal antibody raised against a partial recombinant CFTR.

This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily that is involved in multi-drug resistance. The encoded protein functions as a chloride channel and controls the regulation of other transport pathways. Mutations in this gene are associated with the autosomal recessive disorders cystic fibrosis and congenital bilateral aplasia of the vas deferens. Alternatively spliced transcript variants have been described, many of which result from mutations in this gene. [provided by RefSeq

Sequence: YQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL

Specifications

• Antigen: CFTR
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CFTR.
• Formulation: 50% glycerol
• Gene: CFTR
• Gene Accession No.: NM_000492
• Gene Alias: ABC35/ABCC7/CF/CFTR/MRP/MRP7/TNR-CFTR/dJ760C5.1
• Gene Symbols: CFTR
• Host Species: Mouse
• Immunogen: CFTR (NP_000483, 1381 a.a. to 1480 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1080
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only