CGB2, Mouse, Clone: 4F8, Abnova™

Catalog No.	Quantity
89-107-540	200 μL

Catalog No. 89-107-540 Supplier Abnova Corporation Supplier No. H00114336M02A

Description

Mouse monoclonal antibody raised against a partial recombinant CGB2.

The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone beta (LHB) subunit gene. The CGB genes are primarily distinguished by differences in the 5' untranscribed region. This gene was originally thought to be one of the two pseudogenes (CGB1 and CGB2) of CGB subunit, however, detection of CGB1 and CGB2 transcripts in vivo, and their presence on the polysomes, suggested that these transcripts are translated. To date, a protein product corresponding to CGB2 has not been isolated. The deduced sequence of the hypothetical protein of 132 aa does not share any similarity with that of functional CGB subunits (PMID:8954017). However, a 163 aa protein, translated from a different frame, is about the same size, and shares 98% identity with other CGB subunits. [provided by RefSeq]

Sequence: MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQGAASATVPPHQCHPGCGEGG

Specifications

• Antigen: CGB2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4F8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CGB2.
• Formulation: ascites with no preservative
• Gene: CGB2
• Gene Accession No.: NM_033378
• Gene Symbols: CGB2
• Host Species: Mouse
• Immunogen: CGB2 (NP_203696,1 a.a. ∽ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 114336
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ