CLCA2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-128	50 μL

Catalog No. 89-106-128 Supplier Abnova Corporation Supplier No. H00009635A01

Description

Mouse polyclonal antibody raised against a partial recombinant CLCA2.

The protein encoded by this gene belongs to the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same site on chromosome 1p31-p22 and share high degrees of homology in size, sequence and predicted structure, but differ significantly in their tissue distributions. Since this protein is expressed predominantly in trachea and lung, it is suggested to play a role in the complex pathogenesis of cystic fibrosis. It may also serve as adhesion molecule for lung metastatic cancer cells, mediating vascular arrest and colonization, and furthermore, it has been implicated to act as a tumor suppressor gene for breast cancer. [provided by RefSeq

Sequence: PTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGF

Specifications

• Antigen: CLCA2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CLCA2.
• Formulation: 50% glycerol
• Gene: CLCA2
• Gene Accession No.: NM_006536
• Gene Alias: CACC/CACC3/CLCRG2/CaCC-3/FLJ97885
• Gene Symbols: CLCA2
• Host Species: Mouse
• Immunogen: CLCA2 (NP_006527, 300 a.a. to 400 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9635
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only