Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106620

CLCF1, Mouse, Clone: 7E10, Abnova™

Catalog No. 89106620 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-620 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-620 Supplier Abnova Corporation Supplier No. H00023529M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant CLCF1.

CLCF1 belongs to the interleukin-6 (IL6; MIM 147620) family of cytokines, which are involved in cell signaling through phosphorylation of gp130 (IL6ST; MIM 600694). IL6 family members share similarity in gene structure and have a 4-helix bundle in their protein structure.[supplied by OMIM

Sequence: NRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

Specifications

Antigen CLCF1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 7E10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant CLCF1.
Formulation ascites with no preservative
Gene CLCF1
Gene Accession No. BC012939
Gene Alias BSF3/CISS2/CLC/NNT1/NR6
Gene Symbols CLCF1
Host Species Mouse
Immunogen CLCF1 (AAH12939,29 a.a. ∽ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23529
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.