CLCF1, Mouse, Clone: 7E10, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CLCF1.

Supplier:  Abnova Corporation H00023529M01A

Catalog No. 89-106-620

Description

CLCF1 belongs to the interleukin-6 (IL6; MIM 147620) family of cytokines, which are involved in cell signaling through phosphorylation of gp130 (IL6ST; MIM 600694). IL6 family members share similarity in gene structure and have a 4-helix bundle in their protein structure.[supplied by OMIM

Sequence: NRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

Specifications

• Antigen: CLCF1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC012939
• Gene Symbols: CLCF1
• Immunogen: CLCF1 (AAH12939,29 a.a. ∽ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 23529
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 7E10
• Description: Mouse monoclonal antibody raised against a full-length recombinant CLCF1.
• Gene: CLCF1
• Gene Alias: BSF3/CISS2/CLC/NNT1/NR6
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ