COL5A3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-829	50 μL

Catalog No. 89-106-829 Supplier Abnova Corporation Supplier No. H00050509A01

Description

Mouse polyclonal antibody raised against a partial recombinant COL5A3.

This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. Mutations in this gene are thought to be responsible for the symptoms of a subset of patients with Ehlers-Danlos syndrome type III. Messages of several sizes can be detected in northern blots but sequence information cannot confirm the identity of the shorter messages. [provided by RefSeq

Sequence: EMVTLVADCEAQPPVLGHGPRFISIAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPETPRP

Specifications

• Antigen: COL5A3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant COL5A3.
• Formulation: 50% glycerol
• Gene: COL5A3
• Gene Accession No.: NM_015719
• Gene Symbols: COL5A3
• Host Species: Mouse
• Immunogen: COL5A3 (NP_056534, 157 a.a. to 244 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 50509
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only