COL9A1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-304	50 μL

Catalog No. 89-104-304 Supplier Abnova Corporation Supplier No. H00001297A01

Description

Mouse polyclonal antibody raised against a partial recombinant COL9A1.

This gene encodes one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component of hyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen. Studies in knockout mice have shown that synthesis of the alpha 1 chain is essential for assembly of type IX collagen molecules, a heterotrimeric molecule, and that lack of type IX collagen is associated with early onset osteoarthritis. Mutations in this gene are associated with osteoarthritis in humans, with multiple epiphyseal dysplasia, 6, a form of chondrodysplasia, and with Stickler syndrome, a disease characterized by ophthalmic, orofacial, articular, and auditory defects. Two transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq

Sequence: AVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQ

Specifications

• Antigen: COL9A1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant COL9A1.
• Formulation: 50% glycerol
• Gene: COL9A1
• Gene Accession No.: NM_001851
• Gene Alias: DJ149L1.1.2/EDM6/FLJ40263/MED
• Gene Symbols: COL9A1
• Host Species: Mouse
• Immunogen: COL9A1 (NP_001842, 24 a.a. to 132 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1297
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only