Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89104306

COL9A3, Mouse, Clone: 2B5, Abnova™

Catalog No. 89104306 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-306 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-306 Supplier Abnova Corporation Supplier No. H00001299M02A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant COL9A3.

This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia. [provided by RefSeq

Sequence: GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL

Specifications

Antigen COL9A3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2B5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant COL9A3.
Formulation ascites with no preservative
Gene COL9A3
Gene Accession No. NM_001853
Gene Alias DJ885L7.4.1/EDM3/FLJ90759/IDD/MED
Gene Symbols COL9A3
Host Species Mouse
Immunogen COL9A3 (NP_001844,280 a.a. ∽ 338 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1299
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.