Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107214

CPNE5, Mouse, Clone: 2G4, Abnova™

Catalog No. 89107214 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-214 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-214 Supplier Abnova Corporation Supplier No. H00057699M02A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CPNE5.

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Sequence analysis identified multiple alternatively spliced transcript variants but their full-length natures could not be determined. [provided by RefSeq

Sequence: RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD

Specifications

Antigen CPNE5
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2G4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CPNE5.
Formulation ascites with no preservative
Gene CPNE5
Gene Accession No. NM_020939
Gene Alias COPN5/CPN5/DKFZp666C234/KIAA1599
Gene Symbols CPNE5
Host Species Mouse
Immunogen CPNE5 (NP_065990,393 a.a. ∽ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57699
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.