CPNE5, Mouse, Clone: 2G4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CPNE5.

Supplier:  Abnova Corporation H00057699M02A

Catalog No. 89-107-214

Description

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Sequence analysis identified multiple alternatively spliced transcript variants but their full-length natures could not be determined. [provided by RefSeq

Sequence: RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD

Specifications

• Antigen: CPNE5
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_020939
• Gene Symbols: CPNE5
• Immunogen: CPNE5 (NP_065990,393 a.a. ∽ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 57699
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 2G4
• Description: Mouse monoclonal antibody raised against a partial recombinant CPNE5.
• Gene: CPNE5
• Gene Alias: COPN5/CPN5/DKFZp666C234/KIAA1599
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ