CRB1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-603	50 μL

Catalog No. 89-106-603 Supplier Abnova Corporation Supplier No. H00023418A01

Description

Mouse polyclonal antibody raised against a partial recombinant CRB1.

This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternatively spliced transcript variants have been observed but their full-length nature has yet to be determined. [provided by RefSeq

Sequence: FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVC

Specifications

• Antigen: CRB1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CRB1.
• Formulation: 50% glycerol
• Gene: CRB1
• Gene Accession No.: NM_012076
• Gene Alias: LCA8/RP12
• Gene Symbols: CRB1
• Host Species: Mouse
• Immunogen: CRB1 (NP_036208, 26 a.a. to 134 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23418
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only