CREB5, Mouse, Clone: 1E2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CREB5.

Supplier:  Abnova Corporation H00009586M01A

Catalog No. 89-106-115

Description

The product of this gene belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. The encoded protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKA

Specifications

• Antigen: CREB5
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_001011666
• Gene Symbols: CREB5
• Immunogen: CREB5 (NP_001011666,1 a.a. ∽ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 9586
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 1E2
• Description: Mouse monoclonal antibody raised against a partial recombinant CREB5.
• Gene: CREB5
• Gene Alias: CRE-BPA
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ