CRX, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-323	50 μL

Catalog No. 89-104-323 Supplier Abnova Corporation Supplier No. H00001406A01

Description

Mouse polyclonal antibody raised against a partial recombinant CRX.

The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq

Sequence: MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR

Specifications

• Antigen: CRX
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CRX.
• Formulation: 50% glycerol
• Gene: CRX
• Gene Accession No.: NM_000554
• Gene Alias: CORD2/CRD/LCA7/OTX3
• Gene Symbols: CRX
• Host Species: Mouse
• Immunogen: CRX (NP_000545, 1 a.a. to 95 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1406
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only