CSE1L (M02A), Mouse anti-Human, Clone: 1E4, Abnova™

Catalog No.	Quantity
89-104-332	200 μL

Catalog No. 89-104-332 Supplier Abnova Corporation Supplier No. H00001434M02A

Description

Mouse monoclonal antibody raised against a partial recombinant CSE1L.

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. [provided by RefSeq

Sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL

Specifications

• Antigen: CSE1L
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1E4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CSE1L.
• Formulation: ascites with no preservative
• Gene: CSE1L
• Gene Accession No.: NM_001316
• Gene Alias: CAS/CSE1/MGC117283/MGC130036/MGC130037/XPO2
• Gene Symbols: CSE1L
• Host Species: Mouse
• Immunogen: CSE1L (NP_001307,872 a.a. ∽ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1434
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ