CSF3R, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-338	50 μL

Catalog No. 89-104-338 Supplier Abnova Corporation Supplier No. H00001441A01

Description

Mouse polyclonal antibody raised against a partial recombinant CSF3R.

The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Four transcript variants encoding four different isoforms have been found for this gene, with three of the isoforms being membrane-bound and the other being secreted and soluble. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia. [provided by RefSeq

Sequence: ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMN

Specifications

• Antigen: CSF3R
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CSF3R.
• Formulation: 50% glycerol
• Gene: CSF3R
• Gene Accession No.: BC053585
• Gene Alias: CD114/GCSFR
• Gene Symbols: CSF3R
• Host Species: Mouse
• Immunogen: CSF3R (AAH53585, 25 a.a. to 134 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1441
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only