CSTB, Mouse, Clone: S3, Abnova™

Catalog No.	Quantity
89-104-346	200 μL

Catalog No. 89-104-346 Supplier Abnova Corporation Supplier No. H00001476M02A

Description

Mouse monoclonal antibody raised against a full-length recombinant CSTB.

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). [provided by RefSeq

Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Specifications

• Antigen: CSTB
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: S3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant CSTB.
• Formulation: ascites with no preservative
• Gene: CSTB
• Gene Accession No.: BC003370.1
• Gene Alias: CST6/EPM1/PME/STFB
• Gene Symbols: CSTB
• Host Species: Mouse
• Immunogen: CSTB (AAH03370.1,1 a.a. ∽ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1476
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ