Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107131

CTNNBL1, Mouse, Clone: 5F1, Abnova™

Catalog No. 89107131 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-131 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-131 Supplier Abnova Corporation Supplier No. H00056259M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CTNNBL1.

The protein encoded by this gene contains an acidic domain, a putative bipartite nuclear localization signal, a nuclear export signal, a leucine-isoleucine zipper, and phosphorylation motifs. In addition, the encoded protein contains Armadillo/beta-catenin-like repeats, which have been implicated in protein-protein interactions. Although the function of this protein has not been determined, the C-terminal portion of the protein has been shown to possess apoptosis-inducing activity. [provided by RefSeq

Sequence: EKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLENF

Specifications

Antigen CTNNBL1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5F1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CTNNBL1.
Formulation ascites with no preservative
Gene CTNNBL1
Gene Accession No. BC036739
Gene Alias C20orf33/FLJ21108/NAP/NYD-SP19/P14L/PP8304/dJ633O20.1
Gene Symbols CTNNBL1
Host Species Mouse
Immunogen CTNNBL1 (AAH36739,210 a.a. ∽ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56259
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.