Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CXCL5 (M05A), Mouse anti-Human, Clone: 2A9, Abnova™

Catalog No. 89105422 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-422 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-422 Supplier Abnova Corporation Supplier No. H00006374M05A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant CXCL5.

The protein encoded by this gene is an inflammatory chemokine that belongs to the CXC chemokine family. This chemokine is produced concomitantly with interleukin-8 (IL8) in response to stimulation with either interleukin-1 (IL1) or tumor necrosis factor-alpha (TNFA). This chemokine is a potent chemotaxin involved in neutrophil activation. [provided by RefSeq

Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN

Specifications

Antigen CXCL5
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2A9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant CXCL5.
Formulation ascites with no preservative
Gene CXCL5
Gene Accession No. BC008376
Gene Alias ENA-78/SCYB5
Gene Symbols CXCL5
Host Species Mouse
Immunogen CXCL5 (AAH08376,1 a.a. ∽ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6374
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.