CYP2F1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-364	50 μL

Catalog No. 89-104-364 Supplier Abnova Corporation Supplier No. H00001572A01

Description

Mouse polyclonal antibody raised against a partial recombinant CYP2F1.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to dehydrogenate 3-methylindole, an endogenous toxin derived from the fermentation of tryptophan, as well as xenobiotic substrates such as naphthalene and ethoxycoumarin. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq

Sequence: DDERLLTIIRLINDNFQIMSSPWGELYDIFPSLLDWVPGPHQRIFQNFKCLRDLIAHSVHDHQASLDPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLM

Specifications

• Antigen: CYP2F1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CYP2F1.
• Formulation: 50% glycerol
• Gene: CYP2F1
• Gene Accession No.: NM_000774
• Gene Alias: C2F1/CYP2F/MGC126121
• Gene Symbols: CYP2F1
• Host Species: Mouse
• Immunogen: CYP2F1 (NP_000765, 191 a.a. to 290 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1572
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only