CYP51A1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-368	50 μL

Catalog No. 89-104-368 Supplier Abnova Corporation Supplier No. H00001595A01

Description

Mouse polyclonal antibody raised against a partial recombinant CYP51A1.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein participates in the synthesis of cholesterol by catalyzing the removal of the 14alpha-methyl group from lanosterol. Homologous genes are found in all three eukaryotic phyla, fungi, plants, and animals, suggesting that this is one of the oldest cytochrome P450 genes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: SPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK

Specifications

• Antigen: CYP51A1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CYP51A1.
• Formulation: 50% glycerol
• Gene: CYP51A1
• Gene Accession No.: NM_000786
• Gene Alias: CP51/CYP51/CYPL1/LDM/P450-14DM/P450L1
• Gene Symbols: CYP51A1
• Host Species: Mouse
• Immunogen: CYP51A1 (NP_000777, 410 a.a. to 509 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1595
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only