CYP7A1, Mouse, Clone: 8F1, Abnova™

Catalog No.	Quantity
89-104-366	100 μg

Catalog No. 89-104-366 Supplier Abnova Corporation Supplier No. H00001581M01

Description

Mouse monoclonal antibody raised against a partial recombinant CYP7A1.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway in the liver, which converts cholesterol to bile acids. This reaction is the rate limiting step and the major site of regulation of bile acid synthesis, which is the primary mechanism for the removal of cholesterol from the body. [provided by RefSeq

Sequence: MFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAK

Specifications

• Antigen: CYP7A1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 8F1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CYP7A1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CYP7A1
• Gene Accession No.: NM_000780.3
• Gene Alias: CP7A/CYP7/MGC126826/MGC138389
• Gene Symbols: CYP7A1
• Host Species: Mouse
• Immunogen: CYP7A1 (NP_000771.2,179 a.a. ∽ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Protein A Purification
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1581
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG2a κ