CYSLTR1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CYSLTR1.

Supplier:  Abnova Corporation H00010800A01

Catalog No. 89-106-411

Description

The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR2. This encoded receptor is a member of the superfamily of G protein-coupled receptors. Activation of this receptor by LTD4 results in contraction and proliferation of smooth muscle, oedema, eosinophil migration and damage to the mucus layer in the lung. [provided by RefSeq

Sequence: PYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

Specifications

• Antigen: CYSLTR1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant CYSLTR1.
• Gene: CYSLTR1
• Gene Alias: CYSLT1/CYSLT1R/CYSLTR/HG55/HMTMF81/MGC46139
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC035750
• Gene Symbols: CYSLTR1
• Immunogen: CYSLTR1 (AAH35750, 248 a.a. to 337 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 10800
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only