DAAM1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-544	50 μL

Catalog No. 89-106-544 Supplier Abnova Corporation Supplier No. H00023002A01

Description

Mouse polyclonal antibody raised against a partial recombinant DAAM1.

Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. [provided by RefSeq

Sequence: MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL

Specifications

• Antigen: DAAM1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DAAM1.
• Formulation: 50% glycerol
• Gene: DAAM1
• Gene Accession No.: NM_014992
• Gene Alias: FLJ41657/KIAA0666
• Gene Symbols: DAAM1
• Host Species: Mouse
• Immunogen: DAAM1 (NP_055807, 1 a.a. to 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23002
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only