DAD1, Mouse, Clone: S1, Abnova™

Catalog No.	Quantity
89-104-370	200 μL

Catalog No. 89-104-370 Supplier Abnova Corporation Supplier No. H00001603M03A

Description

Mouse monoclonal antibody raised against a full-length recombinant DAD1.

DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. [provided by RefSeq

Sequence: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Specifications

• Antigen: DAD1
• Applications: ELISA
• Classification: Monoclonal
• Clone: S1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant DAD1.
• Formulation: ascites with no preservative
• Gene: DAD1
• Gene Accession No.: BC007403
• Gene Alias: OST2
• Gene Symbols: DAD1
• Host Species: Mouse
• Immunogen: DAD1 (AAH07403,1 a.a. ∽ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1603
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ