DAND5, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-688	50 μL

Catalog No. 89-107-688 Supplier Abnova Corporation Supplier No. H00199699A01

Description

Mouse polyclonal antibody raised against a partial recombinant DAND5.

This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry. [provided by RefSeq

Sequence: PLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPK

Specifications

• Antigen: DAND5
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DAND5.
• Formulation: 50% glycerol
• Gene: DAND5
• Gene Accession No.: NM_152654
• Gene Alias: CER2/CERL2/CKTSF1B3/COCO/CRL2/DANTE/GREM3/MGC126849/SP1
• Gene Symbols: DAND5
• Host Species: Mouse
• Immunogen: DAND5 (NP_689867, 90 a.a. to 188 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 199699
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only