DAZAP2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-155	50 μL

Catalog No. 89-106-155 Supplier Abnova Corporation Supplier No. H00009802A01

Description

Mouse polyclonal antibody raised against a partial recombinant DAZAP2.

This gene encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW

Specifications

• Antigen: DAZAP2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DAZAP2.
• Formulation: 50% glycerol
• Gene: DAZAP2
• Gene Accession No.: NM_014764
• Gene Alias: KIAA0058/MGC14319/MGC766/PRTB
• Gene Symbols: DAZAP2
• Host Species: Mouse
• Immunogen: DAZAP2 (NP_055579, 93 a.a. to 168 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9802
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only