Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106026

DCAMKL1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89106026 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-026 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-026 Supplier Abnova Corporation Supplier No. H00009201A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant DCAMKL1.

DCAMKL1 is a microtubule-associated protein that phosphorylates itself and myelin basic protein (MBP; MIM 159430). DCAMKL1 has microtubule polymerizing activity that is independent of its protein kinase activity (Lin et al., 2000 [PubMed 11124993]).[supplied by OMIM

Sequence: QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

Specifications

Antigen DCAMKL1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant DCAMKL1.
Formulation 50% glycerol
Gene DCLK1
Gene Accession No. NM_004734
Gene Alias DCAMKL1/DCDC3A/DCLK/KIAA0369
Gene Symbols DCLK1
Host Species Mouse
Immunogen DCAMKL1 (NP_004725, 640 a.a. to 729 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9201
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.