DDOST, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DDOST.

Supplier:  Abnova Corporation H00001650A01

Catalog No. 89-104-383

Description

This gene encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from nonenzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia. [provided by RefSeq

Sequence: TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP

Specifications

• Antigen: DDOST
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant DDOST.
• Gene: DDOST
• Gene Alias: AGE-R1/KIAA0115/MGC2191/OK/SW-cl.45/OST/OST48/WBP1
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005216
• Gene Symbols: DDOST
• Immunogen: DDOST (NP_005207, 328 a.a. to 427 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 1650
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only