DDX18, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-969	50 μL

Catalog No. 89-105-969 Supplier Abnova Corporation Supplier No. H00008886A01

Description

Mouse polyclonal antibody raised against a partial recombinant DDX18.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it is activated by Myc protein. [provided by RefSeq

Sequence: KNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFVDLNVNSNEGKQKKRGGGGGFGYQKTKKVEKSKIFKHISKKSSDSRQFSH

Specifications

• Antigen: DDX18
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DDX18.
• Formulation: 50% glycerol
• Gene: DDX18
• Gene Accession No.: NM_006773
• Gene Alias: FLJ33908/MrDb
• Gene Symbols: DDX18
• Host Species: Mouse
• Immunogen: DDX18 (NP_006764, 571 a.a. to 670 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8886
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only