DEGS1, Mouse, Clone: 3F9, Abnova™

Catalog No.	Quantity
89-105-889	200 μL

Catalog No. 89-105-889 Supplier Abnova Corporation Supplier No. H00008560M01A

Description

Mouse monoclonal antibody raised against a partial recombinant DEGS1.

This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. [provided by RefSeq

Sequence: SGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE

Specifications

• Antigen: DEGS1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3F9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DEGS1.
• Formulation: ascites with no preservative
• Gene: DEGS1
• Gene Accession No.: NM_003676
• Gene Alias: DEGS/DES1/Des-1/FADS7/MGC5079/MIG15/MLD
• Gene Symbols: DEGS1
• Host Species: Mouse
• Immunogen: DEGS1 (NP_003667,226 a.a. ∽ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8560
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ