Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107137

DIABLO, Mouse, Clone: 4F9, Abnova™

Catalog No. 89107137 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-137 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-137 Supplier Abnova Corporation Supplier No. H00056616M02A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant DIABLO.

This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and it moderates the caspase inhibition of IAPs. Multiple polyadenylation sites have been found for this gene. Four alternatively spliced transcript variants have been described for this gene, with two of them encoding different isoforms and the other two probably not encoding a protein. [provided by RefSeq

Sequence: SLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQ

Specifications

Antigen DIABLO
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DIABLO.
Formulation ascites with no preservative
Gene DIABLO
Gene Accession No. BC011909
Gene Alias DIABLO-S/FLJ10537/FLJ25049/SMAC/SMAC3
Gene Symbols DIABLO
Host Species Mouse
Immunogen DIABLO (AAH11909,119 a.a. ∽ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56616
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.