DICER1, Mouse, Clone: 2F12, Abnova™

Catalog No.	Quantity
89-106-599	200 μL

Catalog No. 89-106-599 Supplier Abnova Corporation Supplier No. H00023405M01A

Description

Mouse monoclonal antibody raised against a partial recombinant DICER1.

This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq

Sequence: ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL

Specifications

• Antigen: DICER1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2F12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DICER1.
• Formulation: ascites with no preservative
• Gene: DICER1
• Gene Accession No.: NM_177438
• Gene Alias: DCR1/Dicer/HERNA/KIAA0928
• Gene Symbols: DICER1
• Host Species: Mouse
• Immunogen: DICER1 (NP_803187,1813 a.a. ∽ 1912 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23405
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ