DLG5, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-033	50 μL

Catalog No. 89-106-033 Supplier Abnova Corporation Supplier No. H00009231A01

Description

Mouse polyclonal antibody raised against a partial recombinant DLG5.

This gene encodes a member of the family of discs large (DLG) homologs, a subset of the membrane-associated guanylate kinase (MAGUK) superfamily. The MAGUK proteins are composed of a catalytically inactive guanylate kinase domain, in addition to PDZ and SH3 domains, and are thought to function as scaffolding molecules at sites of cell-cell contact. The protein encoded by this gene localizes to the plasma membrane and cytoplasm, and interacts with components of adherens junctions and the cytoskeleton. It is proposed to function in the transmission of extracellular signals to the cytoskeleton and in the maintenance of epithelial cell structure. Alternative splice variants have been described but their biological nature has not been determined. [provided by RefSeq

Sequence: LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL

Specifications

• Antigen: DLG5
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DLG5.
• Formulation: 50% glycerol
• Gene: DLG5
• Gene Accession No.: NM_004747
• Gene Alias: KIAA0583/LP-DLG/P-DLG5/PDLG
• Gene Symbols: DLG5
• Host Species: Mouse
• Immunogen: DLG5 (NP_004738, 1708 a.a. to 1809 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9231
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only