Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DMN, Mouse, Clone: 4G5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DMN.

Manufacturer:  Abnova Corporation H00023336M03A

Catalog No. 89-106-585


Add to cart

Description

Description

The protein encoded by this gene is an intermediate filament (IF) family member. IF proteins are cytoskeletal proteins that confer resistance to mechanical stress and are encoded by a dispersed multigene family. This protein has been found to form a linkage between desmin, which is a subunit of the IF network, and the extracellular matrix, and provides an important structural support in muscle. Two alternatively spliced variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: VSNVEAIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRSVISDEKKVALLYLDNEEEENDGHWF
Specifications

Specifications

DMN
Monoclonal
Unconjugated
ascites with no preservative
NM_145728
DMN/KIAA0353/SYN
Mouse
IgG1 Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
4G5
Mouse monoclonal antibody raised against a partial recombinant DMN.
SYNM
Ascites
SYNM
DMN (NP_663780.1,1466 a.a. ∽ 1565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
23336
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit