DNAJC3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant DNAJC3.

Supplier:  Abnova Corporation H00005611A01

Catalog No. 89-105-217

Description

The protein encoded by this gene contains multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). [provided by RefSeq

Sequence: MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS

Specifications

• Antigen: DNAJC3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length recombinant DNAJC3.
• Gene: DNAJC3
• Gene Alias: HP58/P58/P58IPK/PRKRI
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC033823
• Gene Symbols: DNAJC3
• Immunogen: DNAJC3 (AAH33823, 1 a.a. to 234 a.a) full-length recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 5611
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only