DOCK4, Mouse, Clone: 3E7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DOCK4.

Supplier:  Abnova Corporation H00009732M01A

Catalog No. 89-106-145

Description

This gene is a member of the dedicator of cytokinesis (DOCK) family and encodes a protein with a DHR-1 (CZH-1) domain, a DHR-2 (CZH-2) domain and an SH3 domain. This membrane-associated, cytoplasmic protein functions as a guanine nucleotide exchange factor and is involved in regulation of adherens junctions between cells. Mutations in this gene have been associated with ovarian, prostate, glioma, and colorectal cancers. Alternatively spliced variants which encode different protein isoforms have been described, but only one has been fully characterized. [provided by RefSeq

Sequence: NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL

Specifications

• Antigen: DOCK4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_014705
• Gene Symbols: DOCK4
• Immunogen: DOCK4 (NP_055520,1867 a.a. ∽ 1966 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 9732
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 3E7
• Description: Mouse monoclonal antibody raised against a partial recombinant DOCK4.
• Gene: DOCK4
• Gene Alias: FLJ34238/KIAA0716/MGC134911/MGC134912
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ