Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106212

DPP3, Mouse, Clone: 4D3, Abnova™

Catalog No. 89106212 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-212 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-212 Supplier Abnova Corporation Supplier No. H00010072M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant DPP3.

This gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternate transcriptional splice variants have been characterized. [provided by RefSeq

Sequence: LTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIAS

Specifications

Antigen DPP3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4D3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DPP3.
Formulation ascites with no preservative
Gene DPP3
Gene Accession No. NM_005700
Gene Alias DPPIII/FLJ11387/FLJ22331
Gene Symbols DPP3
Host Species Mouse
Immunogen DPP3 (NP_005691.2,424 a.a. ∽ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10072
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.