DUOX1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-951	50 μL

Catalog No. 89-106-951 Supplier Abnova Corporation Supplier No. H00053905A01

Description

Mouse polyclonal antibody raised against a partial recombinant DUOX1.

The protein encoded by this gene is a glycoprotein and a member of the NADPH oxidase family. The synthesis of thyroid hormone is catalyzed by a protein complex located at the apical membrane of thyroid follicular cells. This complex contains an iodide transporter, thyroperoxidase, and a peroxide generating system that includes this encoded protein and DUOX2. This protein is known as dual oxidase because it has both a peroxidase homology domain and a gp91phox domain. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq

Sequence: VEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHREKFQRSCLH

Specifications

• Antigen: DUOX1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DUOX1.
• Formulation: 50% glycerol
• Gene: DUOX1
• Gene Accession No.: NM_017434
• Gene Alias: LNOX1/MGC138840/MGC138841/NOXEF1/THOX1
• Gene Symbols: DUOX1
• Host Species: Mouse
• Immunogen: DUOX1 (NP_059130, 941 a.a. to 1028 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 53905
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only