EDAR, Mouse, Clone: 3A7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EDAR.

Supplier:  Abnova Corporation H00010913M02A

Catalog No. 89-106-425

Description

This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq

Sequence: TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL

Specifications

• Antigen: EDAR
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_022336
• Gene Symbols: EDAR
• Immunogen: EDAR (NP_071731,64 a.a. ∽ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 10913
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 3A7
• Description: Mouse monoclonal antibody raised against a partial recombinant EDAR.
• Gene: EDAR
• Gene Alias: DL/ED1R/ED3/ED5/EDA-A1R/EDA1R/EDA3/FLJ94390
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ