EDAR, Mouse, Clone: 3A7, Abnova™

Catalog No.	Quantity
89-106-425	200 μL

Catalog No. 89-106-425 Supplier Abnova Corporation Supplier No. H00010913M02A

Description

Mouse monoclonal antibody raised against a partial recombinant EDAR.

This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq

Sequence: TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL

Specifications

• Antigen: EDAR
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3A7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant EDAR.
• Formulation: ascites with no preservative
• Gene: EDAR
• Gene Accession No.: NM_022336
• Gene Alias: DL/ED1R/ED3/ED5/EDA-A1R/EDA1R/EDA3/FLJ94390
• Gene Symbols: EDAR
• Host Species: Mouse
• Immunogen: EDAR (NP_071731,64 a.a. ∽ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10913
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ