EFHD1, Mouse, Clone: 1F5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EFHD1.

Supplier:  Abnova Corporation H00080303M08A

Catalog No. 89-107-372

Description

EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).[supplied by OMIM

Sequence: GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN

Specifications

• Antigen: EFHD1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_025202
• Gene Symbols: EFHD1
• Immunogen: EFHD1 (NP_079478.1,168 a.a. ∽ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 80303
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 1F5
• Description: Mouse monoclonal antibody raised against a partial recombinant EFHD1.
• Gene: EFHD1
• Gene Alias: DKFZp781H0842/FLJ13612/MST133/MSTP133/PP3051
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ