EGFR, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-418	50 μL

Catalog No. 89-104-418 Supplier Abnova Corporation Supplier No. H00001956A01

Description

Mouse polyclonal antibody raised against a partial recombinant EGFR.

The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. [provided by RefSeq

Sequence: EEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNY

Specifications

• Antigen: EGFR
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant EGFR.
• Formulation: 50% glycerol
• Gene: EGFR
• Gene Accession No.: NM_005228
• Gene Alias: ERBB/ERBB1/HER1/PIG61/mENA
• Gene Symbols: EGFR
• Host Species: Mouse
• Immunogen: EGFR (NP_005219, 26 a.a. to 125 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1956
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only