EHMT1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-341	50 μL

Catalog No. 89-107-341 Supplier Abnova Corporation Supplier No. H00079813A01

Description

Mouse polyclonal antibody raised against a partial recombinant EHMT1.

The protein encoded by this gene is a histone methyltransferase that is part of the E2F6 complex, which represses transcription. The encoded protein methylates the Lys-9 position of histone H3, which tags it for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0/G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA

Specifications

• Antigen: EHMT1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant EHMT1.
• Formulation: 50% glycerol
• Gene: EHMT1
• Gene Accession No.: NM_024757
• Gene Alias: DEL9q34/DKFZp667M072/EUHMTASE1/Eu-HMTase1/FLJ12879/FP13812/GLP/KIAA1876/KMT1D/bA188C12.1
• Gene Symbols: EHMT1
• Host Species: Mouse
• Immunogen: EHMT1 (NP_079033, 1 a.a. to 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 79813
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only