EIF4G2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-423	50 μL

Catalog No. 89-104-423 Supplier Abnova Corporation Supplier No. H00001982A01

Description

Mouse polyclonal antibody raised against a partial recombinant EIF4G2.

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq

Sequence: SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ

Specifications

• Antigen: EIF4G2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant EIF4G2.
• Formulation: 50% glycerol
• Gene: EIF4G2
• Gene Accession No.: NM_001418
• Gene Alias: AAG1/DAP5/FLJ41344/NAT1/p97
• Gene Symbols: EIF4G2
• Host Species: Mouse
• Immunogen: EIF4G2 (NP_001409, 811 a.a. to 889 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1982
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only