ENPP3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-079	50 μL

Catalog No. 89-105-079 Supplier Abnova Corporation Supplier No. H00005169A01

Description

Mouse polyclonal antibody raised against a partial recombinant ENPP3.

The protein encoded by this gene belongs to a series of ectoenzymes that are involved in hydrolysis of extracellular nucleotides. These ectoenzymes possess ATPase and ATP pyrophosphatase activities and are type II transmembrane proteins. Expression of the related rat mRNA has been found in a subset of immature glial cells and in the alimentary tract. The corresponding rat protein has been detected in the pancreas, small intestine, colon, and liver. The human mRNA is expressed in glioma cells, prostate, and uterus. Expression of the human protein has been detected in uterus, basophils, and mast cells. [provided by RefSeq

Sequence: ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN

Specifications

• Antigen: ENPP3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ENPP3.
• Formulation: 50% glycerol
• Gene: ENPP3
• Gene Accession No.: NM_005021
• Gene Alias: B10/CD203c/NPP3/PD-IBETA/PDNP3
• Gene Symbols: ENPP3
• Host Species: Mouse
• Immunogen: ENPP3 (NP_005012, 602 a.a. to 699 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5169
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only