EP300, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-441	50 μL

Catalog No. 89-104-441 Supplier Abnova Corporation Supplier No. H00002033A01

Description

Mouse polyclonal antibody raised against a partial recombinant EP300.

This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer. [provided by RefSeq

Sequence: PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN

Specifications

• Antigen: EP300
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant EP300.
• Formulation: 50% glycerol
• Gene: EP300
• Gene Accession No.: NM_001429
• Gene Alias: KAT3B/p300
• Gene Symbols: EP300
• Host Species: Mouse
• Immunogen: EP300 (NP_001420, 731 a.a. to 830 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2033
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only